Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MITD1 Rabbit Polyclonal Antibody (HRP)

MITD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8WV92

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MITD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_620153

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTHFSD (NM_001159377) Human Over-expression Lysate
LS064779-100ug 100 µg

MTHFSD (NM_001159377) Human Over-expression Lysate

Sign In for Pricing
View Details
Trypsin (TRY) BioAssayTM ELISA Kit (Porcine) discontinued
359492 96 Tests

Trypsin (TRY) BioAssayTM ELISA Kit (Porcine) discontinued

Sign In for Pricing
View Details
Lentiviral human CIDEC shRNA (UAS) - Lentiviral human CIDEC shRNA (UAS, RFP) (100)
GTR15109140 1 Vial

Lentiviral human CIDEC shRNA (UAS) - Lentiviral human CIDEC shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Human Soluble Programmed Death-1 ELISA Kit
MBS026745-01 48 Well

Human Soluble Programmed Death-1 ELISA Kit

Sign In for Pricing
View Details
Human Soluble Programmed Death-1 ELISA Kit
MBS026745-02 96 Well

Human Soluble Programmed Death-1 ELISA Kit

Sign In for Pricing
View Details
Human Soluble Programmed Death-1 ELISA Kit
MBS026745-03 5x 96 Well

Human Soluble Programmed Death-1 ELISA Kit

Sign In for Pricing
View Details