Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M1AP Rabbit Polyclonal Antibody (Biotin)

M1AP Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

D6Mm5e, SPGF48, C2orf65, SPATA37

UniProt

Q8TC57

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of HUMAN M1AP

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human G protein-activated inward rectifier potassium channel 1 (KCNJ3) (F137S)
CSB-CF012056HU(M)-01 20 µg

Recombinant Human G protein-activated inward rectifier potassium channel 1 (KCNJ3) (F137S)

Sign In for Pricing
View Details
Recombinant Human G protein-activated inward rectifier potassium channel 1 (KCNJ3) (F137S)
CSB-CF012056HU(M)-02 100 µg

Recombinant Human G protein-activated inward rectifier potassium channel 1 (KCNJ3) (F137S)

Sign In for Pricing
View Details
Camel Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 ELISA Kit
MBS075561-01 48 Well

Camel Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 ELISA Kit

Sign In for Pricing
View Details
Camel Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 ELISA Kit
MBS075561-02 96 Well

Camel Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 ELISA Kit

Sign In for Pricing
View Details
Camel Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 ELISA Kit
MBS075561-03 5x 96 Well

Camel Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 ELISA Kit

Sign In for Pricing
View Details
Camel Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 ELISA Kit
MBS075561-04 10x 96 Well

Camel Carcinoembryonic Antigen Related Cell Adhesion Molecule 1 ELISA Kit

Sign In for Pricing
View Details