Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

M1AP Rabbit Polyclonal Antibody (HRP)

M1AP Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

D6Mm5e, SPGF48, C2orf65, SPATA37

UniProt

Q8TC57

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of HUMAN M1AP

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Human, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIMCH1 Protein Vector (Human) (pPM-C-HA)
PV023743 500 ng

LIMCH1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Transmembrane glycoprotein NMB ELISA Kit
MBS9428370-01 96 Tests

Mouse Transmembrane glycoprotein NMB ELISA Kit

Sign In for Pricing
View Details
Mouse Transmembrane glycoprotein NMB ELISA Kit
MBS9428370-02 5x 96 Tests

Mouse Transmembrane glycoprotein NMB ELISA Kit

Sign In for Pricing
View Details
H-AP190 primer
H-AP190 150 µL

H-AP190 primer

Sign In for Pricing
View Details
13-cis-Retinoic acid
BML-GR102-0500 500 mg

13-cis-Retinoic acid

Sign In for Pricing
View Details
ABCB6 (ATP-binding Cassette Sub-family B Member 6, Mitochondrial, Mitochondrial ABC Transporter 3, Mt-ABC Transporter 3, Ubiquitously-expressed Mammalian ABC Half Transporter, P-glycoprotein-related Protein, MTABC3, PRP, UMAT) (PE)
122795-PE 100 µL

ABCB6 (ATP-binding Cassette Sub-family B Member 6, Mitochondrial, Mitochondrial ABC Transporter 3, Mt-ABC Transporter 3, Ubiquitously-expressed Mammalian ABC Half Transporter, P-glycoprotein-related Protein, MTABC3, PRP, UMAT) (PE)

Sign In for Pricing
View Details