Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C7orf31 Rabbit Polyclonal Antibody (HRP)

C7orf31 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8N865

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C7orf31

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_620166

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR1264 Human qPCR Primer Pair (MI0003758)
HP300088 200 Reactions

MIR1264 Human qPCR Primer Pair (MI0003758)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS805659 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
POU2F3 (NM_014352) Human Recombinant Protein
TP310969M 100 µg

POU2F3 (NM_014352) Human Recombinant Protein

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (rCIP1/823), CF594 conjugate, 0.1mg/mL
BNC942292-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (rCIP1/823), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
COX6A1 (Center) Rabbit Polyclonal Antibody
AP51033PU-N 400 µL

COX6A1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Centaurin beta 2 (ACAP2) Human Knockdown Lysate
LY300018 100 µg

Centaurin beta 2 (ACAP2) Human Knockdown Lysate

Sign In for Pricing
View Details