Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPPA2 Rabbit Polyclonal Antibody (HRP)

DPPA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT100, PESCRG1, ECAT15-2

UniProt

Q7Z7J5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_620170

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGFR2 Antibody (monoclonal)
ASA-B1969 1 Each

VEGFR2 Antibody (monoclonal)

Sign In for Pricing
View Details
GNL1 Antibody
orb1266817 400 μl

GNL1 Antibody

Sign In for Pricing
View Details
Lentiviral human MT3 shRNA (UAS) - Lentiviral human MT3 shRNA (UAS, RFP) (25)
GTR15148943 1 Vial

Lentiviral human MT3 shRNA (UAS) - Lentiviral human MT3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Lentiviral human NDUFAF1 shRNA (UAS) - Lentiviral human NDUFAF1 shRNA (UAS, RFP) (25)
GTR15118691 1 Vial

Lentiviral human NDUFAF1 shRNA (UAS) - Lentiviral human NDUFAF1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
CD14 Antibody
orb1671423 0.05 mg

CD14 Antibody

Sign In for Pricing
View Details
Human ERLIN2 (Endoplasmic Reticulum Lipid Raft Associated Protein 2) ELISA Kit
MBS8805971-01 48 Well

Human ERLIN2 (Endoplasmic Reticulum Lipid Raft Associated Protein 2) ELISA Kit

Sign In for Pricing
View Details