Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abra Rabbit Polyclonal Antibody (Biotin)

Abra Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S, STARS, C130068O12Rik

UniProt

Q8BUZ1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KEGSKTAERAKRAEEHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDR

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_780665

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOC4 (Exocyst Complex Component 4, Exocyst Complex Component Sec8, EXOC4, KIAA1699, SEC8, SEC8L1) (FITC)
MBS6455934-01 0.2 mL

EXOC4 (Exocyst Complex Component 4, Exocyst Complex Component Sec8, EXOC4, KIAA1699, SEC8, SEC8L1) (FITC)

Sign In for Pricing
View Details
EXOC4 (Exocyst Complex Component 4, Exocyst Complex Component Sec8, EXOC4, KIAA1699, SEC8, SEC8L1) (FITC)
MBS6455934-02 5x 0.2 mL

EXOC4 (Exocyst Complex Component 4, Exocyst Complex Component Sec8, EXOC4, KIAA1699, SEC8, SEC8L1) (FITC)

Sign In for Pricing
View Details
TRDN CRISPR All-in-one AAV vector set (with saCas9)(Rat)
47694156 3x 1.0 µg DNA

TRDN CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Human Beta-hexosaminidase subunit beta (HEXB) ELISA Kit
YLA4525HU-01 48 Tests

Human Beta-hexosaminidase subunit beta (HEXB) ELISA Kit

Sign In for Pricing
View Details
Human Beta-hexosaminidase subunit beta (HEXB) ELISA Kit
YLA4525HU-02 96 Tests

Human Beta-hexosaminidase subunit beta (HEXB) ELISA Kit

Sign In for Pricing
View Details
VEGF145 (Vascular Endothelial Growth Factor 145)
365556 200 µL

VEGF145 (Vascular Endothelial Growth Factor 145)

Sign In for Pricing
View Details