Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Abra Rabbit Polyclonal Antibody (FITC)

Abra Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

S, STARS, C130068O12Rik

UniProt

Q8BUZ1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KEGSKTAERAKRAEEHIYREIMELCFVIRTMARHRRDGKIQVTFGELFDR

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_780665

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Orexin receptor type 2 (HCRTR2), partial
CSB-EP010232HU1-01 20 µg

Recombinant Human Orexin receptor type 2 (HCRTR2), partial

Sign In for Pricing
View Details
Recombinant Human Orexin receptor type 2 (HCRTR2), partial
CSB-EP010232HU1-02 100 µg

Recombinant Human Orexin receptor type 2 (HCRTR2), partial

Sign In for Pricing
View Details
Recombinant Human Orexin receptor type 2 (HCRTR2), partial
CSB-EP010232HU1-03 1 mg

Recombinant Human Orexin receptor type 2 (HCRTR2), partial

Sign In for Pricing
View Details
PLD1 Rabbit pAb
MBS8549753-01 0.1 mL

PLD1 Rabbit pAb

Sign In for Pricing
View Details
PLD1 Rabbit pAb
MBS8549753-02 0.1 mL (AF405L)

PLD1 Rabbit pAb

Sign In for Pricing
View Details
PLD1 Rabbit pAb
MBS8549753-03 0.1 mL (AF405S)

PLD1 Rabbit pAb

Sign In for Pricing
View Details