Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAIN1 Rabbit Polyclonal Antibody (FITC)

SLAIN1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C13orf32

UniProt

Q8ND83

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLAIN1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rpgr shRNA (UAS) - Lentiviral mouse Rpgr shRNA (UAS, RFP) (100)
GTR15136812 1 Vial

Lentiviral mouse Rpgr shRNA (UAS) - Lentiviral mouse Rpgr shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
RAP2A Rabbit Polyclonal Antibody (Biotin)
orb2092954 100 µL

RAP2A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
BRCA1, Phosphorylated (S1423) (Breast Cancer 1, Breast Cancer 1 Early Onset, IRIS, PSCP, BRCAI, BRCC1, PNCA4, RNF53, BROVCA1, PPP1R53) (Biotin)
MBS6408810-01 0.1 mL

BRCA1, Phosphorylated (S1423) (Breast Cancer 1, Breast Cancer 1 Early Onset, IRIS, PSCP, BRCAI, BRCC1, PNCA4, RNF53, BROVCA1, PPP1R53) (Biotin)

Sign In for Pricing
View Details
BRCA1, Phosphorylated (S1423) (Breast Cancer 1, Breast Cancer 1 Early Onset, IRIS, PSCP, BRCAI, BRCC1, PNCA4, RNF53, BROVCA1, PPP1R53) (Biotin)
MBS6408810-02 5x 0.1 mL

BRCA1, Phosphorylated (S1423) (Breast Cancer 1, Breast Cancer 1 Early Onset, IRIS, PSCP, BRCAI, BRCC1, PNCA4, RNF53, BROVCA1, PPP1R53) (Biotin)

Sign In for Pricing
View Details
Mouse recombinant CD200 protein
PROTO54901-1-10ug 10 µg

Mouse recombinant CD200 protein

Sign In for Pricing
View Details
Pig Nuclear receptor coactivator 1 (NCOA1) ELISA Kit
AE31560PI-01 48 Tests

Pig Nuclear receptor coactivator 1 (NCOA1) ELISA Kit

Sign In for Pricing
View Details