Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEPT12 Rabbit Polyclonal Antibody (HRP)

SEPT12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sept, Sept12, 1700028G04Rik, 4933413B09Rik

UniProt

Q9D451

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KGLKLKLTVTDTPGFGDQINNDKCWDPILSYINQQYEQYLQEELLITRQR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_081945

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYNX1 siRNA Oligos set (Human)
27836171 3x 5 nmol

LYNX1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Goat Chromodomain-helicase-DNA-binding protein 6 (CHD6) ELISA Kit
MBS7248377-01 48 Well

Goat Chromodomain-helicase-DNA-binding protein 6 (CHD6) ELISA Kit

Sign In for Pricing
View Details
Goat Chromodomain-helicase-DNA-binding protein 6 (CHD6) ELISA Kit
MBS7248377-02 96 Well

Goat Chromodomain-helicase-DNA-binding protein 6 (CHD6) ELISA Kit

Sign In for Pricing
View Details
Goat Chromodomain-helicase-DNA-binding protein 6 (CHD6) ELISA Kit
MBS7248377-03 5x 96 Well

Goat Chromodomain-helicase-DNA-binding protein 6 (CHD6) ELISA Kit

Sign In for Pricing
View Details
Goat Chromodomain-helicase-DNA-binding protein 6 (CHD6) ELISA Kit
MBS7248377-04 10x 96 Well

Goat Chromodomain-helicase-DNA-binding protein 6 (CHD6) ELISA Kit

Sign In for Pricing
View Details
Monoclonal Tyrosinase (Melanoma Marker) Antibody - Without BSA and Azide, Clone: SPM360
APG01330G 0.1mg

Monoclonal Tyrosinase (Melanoma Marker) Antibody - Without BSA and Azide, Clone: SPM360

Sign In for Pricing
View Details