Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYB5D1 Rabbit Polyclonal Antibody (HRP)

CYB5D1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ32499

UniProt

Q6P9G0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYB5D1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTEL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_653208

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Claritas PPT Grade Boron for ICP-MS 1 ug/mL (1 PPM) 125mL in H2O
CLB9-1BY 125 mL

Claritas PPT Grade Boron for ICP-MS 1 ug/mL (1 PPM) 125mL in H2O

Sign In for Pricing
View Details
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (MaxLight 405)
MBS6195869-01 0.1 mL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (MaxLight 405)

Sign In for Pricing
View Details
HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (MaxLight 405)
MBS6195869-02 5x 0.1 mL

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (MaxLight 405)

Sign In for Pricing
View Details
MTA3 Antibody
MBS9603349-01 0.1 mL

MTA3 Antibody

Sign In for Pricing
View Details
MTA3 Antibody
MBS9603349-02 0.2 mL

MTA3 Antibody

Sign In for Pricing
View Details
MTA3 Antibody
MBS9603349-03 5x 0.2 mL

MTA3 Antibody

Sign In for Pricing
View Details