Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFTN2 Rabbit Polyclonal Antibody (HRP)

RFTN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C2orf11, Raftlin-2

UniProt

Q52LD8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RFTN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_653230

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Capsicum annuum E3 ubiquitin-protein ligase RMA1H1 (RMA1H1)
MBS7028694-01 0.02 mg

Recombinant Capsicum annuum E3 ubiquitin-protein ligase RMA1H1 (RMA1H1)

Sign In for Pricing
View Details
Recombinant Capsicum annuum E3 ubiquitin-protein ligase RMA1H1 (RMA1H1)
MBS7028694-02 0.1 mg

Recombinant Capsicum annuum E3 ubiquitin-protein ligase RMA1H1 (RMA1H1)

Sign In for Pricing
View Details
Recombinant Capsicum annuum E3 ubiquitin-protein ligase RMA1H1 (RMA1H1)
MBS7028694-03 5x 0.1 mg

Recombinant Capsicum annuum E3 ubiquitin-protein ligase RMA1H1 (RMA1H1)

Sign In for Pricing
View Details
Ara-Cytidine-5′-diphosphate (ara-CDP), S pack
JBS-NU-1171S 50 μL

Ara-Cytidine-5′-diphosphate (ara-CDP), S pack

Sign In for Pricing
View Details
Fmoc- (2S,4S) - (-) -4-hydroxypyrrolidine-2-carboxylic acid
sc-327606 250 mg

Fmoc- (2S,4S) - (-) -4-hydroxypyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Phenylalanine (Phe)
MBS2085389-01 0.1 mL

PE-Linked Polyclonal Antibody to Phenylalanine (Phe)

Sign In for Pricing
View Details