Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1M Rabbit Polyclonal Antibody (HRP)

PPM1M Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PP2CE, PP2Ceta, PP2C-eta

UniProt

Q96MI6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPM1M

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653242

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIV-1 P24, Rec. Ag
orb1785680 1 mg

HIV-1 P24, Rec. Ag

Sign In for Pricing
View Details
Snap29 Blocking Peptide
33R-6878 0.1 mg

Snap29 Blocking Peptide

Sign In for Pricing
View Details
Mmu-miR-467e-3p agomir
HY-R03202A-01 5 nmol

Mmu-miR-467e-3p agomir

Sign In for Pricing
View Details
Mmu-miR-467e-3p agomir
HY-R03202A-02 20 nmol

Mmu-miR-467e-3p agomir

Sign In for Pricing
View Details
Lentiviral mouse Spag8 shRNA (UAS) - Lentiviral mouse Spag8 shRNA (UAS, iRFP) plasmid
GTR15244276 1 Vial

Lentiviral mouse Spag8 shRNA (UAS) - Lentiviral mouse Spag8 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
HBEGF Mouse Monoclonal Antibody (FITC)
orb2973557-01 50 Tests

HBEGF Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details