Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1M Rabbit Polyclonal Antibody (Biotin)

PPM1M Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PP2CE, PP2Ceta, PP2C-eta

UniProt

Q96MI6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PPM1M

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTL

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001116342

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Human IFN-γ Antibody[B27]
E-AB-F1196M1-01 20 Tests

Elab Fluor® 700 Anti-Human IFN-γ Antibody[B27]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human IFN-γ Antibody[B27]
E-AB-F1196M1-02 100 Tests

Elab Fluor® 700 Anti-Human IFN-γ Antibody[B27]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human IFN-γ Antibody[B27]
E-AB-F1196M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human IFN-γ Antibody[B27]

Sign In for Pricing
View Details
Cytokeratin 8 (H1), CF488A conjugate, 0.1mg/mL
BNC880334-100 1x 100 µL

Cytokeratin 8 (H1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (Mouse) Recombinant Monoclonal Rat Antibody (24MS04.9) – Biotium Choice
P016-5MG 1x 2500 µL

CD9 (Mouse) Recombinant Monoclonal Rat Antibody (24MS04.9) – Biotium Choice

Sign In for Pricing
View Details
SEMA4D Polyclonal Antibody
D-AB-10380L-01 25 µL

SEMA4D Polyclonal Antibody

Sign In for Pricing
View Details