Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM76B Rabbit Polyclonal Antibody (FITC)

FAM76B Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q5HYJ3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FA76B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TKCTQRYPFEELSQGQQLCKECRIAHPIVKCTYCRSEFQQESKTNTICKK

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH21 ORF Vector (Human) (pORF)
36112011 1.0 µg DNA

PCDH21 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
LSM12 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-18436R-PerCP-Cy5.5 100 µL

LSM12 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
CNOT4 rabbit pAb
ES6405-01 50 µL

CNOT4 rabbit pAb

Sign In for Pricing
View Details
CNOT4 rabbit pAb
ES6405-02 100 µL

CNOT4 rabbit pAb

Sign In for Pricing
View Details
SGMS1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2137108 1.0 µg DNA

SGMS1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Transcriptional Intermediary Factor 1 Beta (TIF1b)
MBS2165795-01 0.1 mL

APC-Linked Polyclonal Antibody to Transcriptional Intermediary Factor 1 Beta (TIF1b)

Sign In for Pricing
View Details