Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM76B Rabbit Polyclonal Antibody (HRP)

FAM76B Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5HYJ3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human FA76B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKCTQRYPFEELSQGQQLCKECRIAHPIVKCTYCRSEFQQESKTNTICKK

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1F Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F10]
TA502388BM 100 µL

ATP6V1F Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F10]

Sign In for Pricing
View Details
NDUFB10 Rabbit Polyclonal Antibody
TA379008 100 µL

NDUFB10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CENPI (Center) Rabbit Polyclonal Antibody
AP50855PU-N 400 µL

CENPI (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNASE9 (NM_001110358) Human Over-expression Lysate
LY426322 100 µg

RNASE9 (NM_001110358) Human Over-expression Lysate

Sign In for Pricing
View Details
DOCK8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8D9]
TA801833BM 100 µL

DOCK8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8D9]

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF405S conjugate, 0.1mg/mL
BNC041976-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details