Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR66 Rabbit Polyclonal Antibody (Biotin)

WDR66 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

WDR66, SPGF33, CaM-IP4

UniProt

Q8TBY9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human WDR66

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DLSTQIEFLDLDQISPEEQQISSPERQPSGELEEKTDRMPQDELGQERRD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig COL1 ELISA Kit
EGC0021 96 Tests

Guinea Pig COL1 ELISA Kit

Sign In for Pricing
View Details
CHCHD7 (NM_001011667) Human Tagged ORF Clone Lentiviral Particle
RC224377L4V 200 µL

CHCHD7 (NM_001011667) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human Perilipin 1 (PLIN1) ELISA Kit
RDR-PLIN1-Hu-01 96 Tests

Human Perilipin 1 (PLIN1) ELISA Kit

Sign In for Pricing
View Details
Human Perilipin 1 (PLIN1) ELISA Kit
RDR-PLIN1-Hu-02 48 Tests

Human Perilipin 1 (PLIN1) ELISA Kit

Sign In for Pricing
View Details
KHK Recombinant Protein (Human)
OPCA04966-100UG 100 µg

KHK Recombinant Protein (Human)

Sign In for Pricing
View Details
5000μL Filter Pipette Tips, Clear, Sterile, Non-Pyrogenic, DNase and RNase Free, Endotoxin Free, 24pcs*15racks/Carton For Eppendorf Pipettes/Sartorius
21082302 360 PCS

5000μL Filter Pipette Tips, Clear, Sterile, Non-Pyrogenic, DNase and RNase Free, Endotoxin Free, 24pcs*15racks/Carton For Eppendorf Pipettes/Sartorius

Sign In for Pricing
View Details