Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ccdc42 Rabbit Polyclonal Antibody (HRP)

Ccdc42 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1565925

UniProt

D3ZAZ8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Ccdc42

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENSEFEEIHEVIARYKTLVSMHHDLMQSAQEGQEKIEHAKARLARYMEEK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001100479

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPZ2 Rabbit pAb, PerCP-Cy7 conjugated
orb2876290 100 µL

COPZ2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Acetic Acid 5% Solution
RRSP401-G 5 L

Acetic Acid 5% Solution

Sign In for Pricing
View Details
Cdk2, CT (Cdk2, Cdkn2, Cyclin-dependent kinase 2, Cell division protein kinase 2) (APC) discontinued
033654-APC 200 µL

Cdk2, CT (Cdk2, Cdkn2, Cyclin-dependent kinase 2, Cell division protein kinase 2) (APC) discontinued

Sign In for Pricing
View Details
MAPKAP Kinase 2 Polyclonal Antibody, PerCP Conjugated
bs-2908R-PerCP-TR 20 µL

MAPKAP Kinase 2 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Ammonium Acetate 98% AR
17700500 500 mg

Ammonium Acetate 98% AR

Sign In for Pricing
View Details
Anti-Influenza A virus NP/Nucleoprotein protein (VHH1) (Mouse, Monoclonal, VHH-mFc)
A130329 100 µL

Anti-Influenza A virus NP/Nucleoprotein protein (VHH1) (Mouse, Monoclonal, VHH-mFc)

Sign In for Pricing
View Details