Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM82A Rabbit Polyclonal Antibody (HRP)

FAM82A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RMD2, RMD4, RMD-2, FAM82A, BLOCK18, FAM82A1, PRO34163, PYST9371

UniProt

Q96LZ7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FAM82A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WRFARAYGDMYELSTNTQEKKHYANIGKTLSERAINRAPMNGHCHLWYAV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653314

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRG1 Peptide - N-terminal region
MBS3235759-01 0.1 mg

LRG1 Peptide - N-terminal region

Sign In for Pricing
View Details
LRG1 Peptide - N-terminal region
MBS3235759-02 5x 0.1 mg

LRG1 Peptide - N-terminal region

Sign In for Pricing
View Details
Human LHX6 (NM_199160) AAV Particle
RC214132A1V 250 µL

Human LHX6 (NM_199160) AAV Particle

Sign In for Pricing
View Details
Monoclonal Antibody to Eosinophil Peroxidase (EPX)
TRV-0060301-01 20 µL

Monoclonal Antibody to Eosinophil Peroxidase (EPX)

Sign In for Pricing
View Details
Monoclonal Antibody to Eosinophil Peroxidase (EPX)
TRV-0060301-02 100 µL

Monoclonal Antibody to Eosinophil Peroxidase (EPX)

Sign In for Pricing
View Details
Monoclonal Antibody to Eosinophil Peroxidase (EPX)
TRV-0060301-03 200 µL

Monoclonal Antibody to Eosinophil Peroxidase (EPX)

Sign In for Pricing
View Details