Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFHB Rabbit Polyclonal Antibody (Biotin)

EFHB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CFAP21

UniProt

Q8N7U6

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human EFHB

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YGEEGSAYSLLYPTIFARKGVFERDFFKTRSKEEIAEILCNIGVKLSDEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

77kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Vascular Endothelial Growth Factor D (VEGF-D) ELISA Kit
MBS2600432-01 48 Well

Guinea pig Vascular Endothelial Growth Factor D (VEGF-D) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Vascular Endothelial Growth Factor D (VEGF-D) ELISA Kit
MBS2600432-02 96 Well

Guinea pig Vascular Endothelial Growth Factor D (VEGF-D) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Vascular Endothelial Growth Factor D (VEGF-D) ELISA Kit
MBS2600432-03 5x 96 Well

Guinea pig Vascular Endothelial Growth Factor D (VEGF-D) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Vascular Endothelial Growth Factor D (VEGF-D) ELISA Kit
MBS2600432-04 10x 96 Well

Guinea pig Vascular Endothelial Growth Factor D (VEGF-D) ELISA Kit

Sign In for Pricing
View Details
Rat Naa16 Pre-designed siRNA Set A
SI208989A 1 Each

Rat Naa16 Pre-designed siRNA Set A

Sign In for Pricing
View Details
RPL23AP27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV778440 1.0 µg DNA

RPL23AP27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details