Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THAP6 Rabbit Polyclonal Antibody (HRP)

THAP6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC30052

UniProt

Q8TBB0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human THAP6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYNH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_653322

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PQLC1, ID (PQLC1, PQ-loop repeat-containing protein 1) (MaxLight 650)
MBS6336838-01 0.1 mL

PQLC1, ID (PQLC1, PQ-loop repeat-containing protein 1) (MaxLight 650)

Sign In for Pricing
View Details
PQLC1, ID (PQLC1, PQ-loop repeat-containing protein 1) (MaxLight 650)
MBS6336838-02 5x 0.1 mL

PQLC1, ID (PQLC1, PQ-loop repeat-containing protein 1) (MaxLight 650)

Sign In for Pricing
View Details
WL Nutrient Medium
RDM-WNA-01 500 g

WL Nutrient Medium

Sign In for Pricing
View Details
Lentiviral human PSMB2 shRNA (UAS) - Lentiviral human PSMB2 shRNA (UAS, GFP) (25)
GTR15151028 1 Vial

Lentiviral human PSMB2 shRNA (UAS) - Lentiviral human PSMB2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Guinea pig Olfactory receptor 2Z1 (OR2Z1) ELISA Kit
MBS7203509-01 48 Well

Guinea pig Olfactory receptor 2Z1 (OR2Z1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Olfactory receptor 2Z1 (OR2Z1) ELISA Kit
MBS7203509-02 96 Well

Guinea pig Olfactory receptor 2Z1 (OR2Z1) ELISA Kit

Sign In for Pricing
View Details