Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND5B Rabbit Polyclonal Antibody (HRP)

DENND5B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DENND5B

UniProt

Q6ZUT9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human DENND5B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILPASLLHFLDAPVPYLMGLQSKEGTDRSKLELPQEANLCFVDIDNHFIE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Minichromosome Maintenance Deficient 3 (MCM3) Antibody
abx027744-01 80 µL

Minichromosome Maintenance Deficient 3 (MCM3) Antibody

Sign In for Pricing
View Details
Minichromosome Maintenance Deficient 3 (MCM3) Antibody
abx027744-02 400 µL

Minichromosome Maintenance Deficient 3 (MCM3) Antibody

Sign In for Pricing
View Details
RAC1+RAC2 Rabbit Polyclonal Antibody (Cy5)
orb888786 100 µL

RAC1+RAC2 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Recombinant Drosophila grimshawi Tryptophan 2,3-dioxygenase (v)
MBS1103125-01 0.02 mg (E-Coli)

Recombinant Drosophila grimshawi Tryptophan 2,3-dioxygenase (v)

Sign In for Pricing
View Details
Recombinant Drosophila grimshawi Tryptophan 2,3-dioxygenase (v)
MBS1103125-02 0.02 mg (Yeast)

Recombinant Drosophila grimshawi Tryptophan 2,3-dioxygenase (v)

Sign In for Pricing
View Details
Recombinant Drosophila grimshawi Tryptophan 2,3-dioxygenase (v)
MBS1103125-03 0.1 mg (E-Coli)

Recombinant Drosophila grimshawi Tryptophan 2,3-dioxygenase (v)

Sign In for Pricing
View Details