Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND1B Rabbit Polyclonal Antibody (HRP)

DENND1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAM31B, C1ORF18, C1orf218

UniProt

Q6P3S1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DENND1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YKLLNTLADYLAKELENDLNETLRSLYNHPVPKANTPVNLSVNQEIFIAC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659414

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gde1 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3545203 1.0 µg DNA

Gde1 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PORCN (NM_203475) Human Over-expression Lysate
LC403716 20 µg

PORCN (NM_203475) Human Over-expression Lysate

Sign In for Pricing
View Details
MEM with L-alanyl-L-glutamine (No Glucose)
abx705033 500 mL

MEM with L-alanyl-L-glutamine (No Glucose)

Sign In for Pricing
View Details
Adenylate Kinase 1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-0299R-BF555 100 µL

Adenylate Kinase 1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Mouse KLRD1/CD94 Polyclonal Antibody
orb3150918-01 50 µg

Mouse KLRD1/CD94 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse KLRD1/CD94 Polyclonal Antibody
orb3150918-02 100 µg

Mouse KLRD1/CD94 Polyclonal Antibody

Sign In for Pricing
View Details