Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DENND1B Rabbit Polyclonal Antibody (HRP)

DENND1B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FAM31B, C1ORF18, C1orf218

UniProt

Q6P3S1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DENND1B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVNLSVNQEIFIACEQVLKDQPALVPHSYFIAPDVTGLPTIPESRNLTEY

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_659414

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IHCAb™ HDAC6 (BGT-HDAC6) mouse mAb
B-IMW6120-100uL 100 µL

IHCAb™ HDAC6 (BGT-HDAC6) mouse mAb

Sign In for Pricing
View Details
SUGT1 (Suppressor of G2 Allele of SKP1 Homolog, Sgt1, Protein 40-6-3) (MaxLight 490)
134063-ML490 100 µL

SUGT1 (Suppressor of G2 Allele of SKP1 Homolog, Sgt1, Protein 40-6-3) (MaxLight 490)

Sign In for Pricing
View Details
MDC1 (NM_014641) Human 3' UTR Clone
SC208778 10 µg

MDC1 (NM_014641) Human 3' UTR Clone

Sign In for Pricing
View Details
MOUSE ANTI RAT CD11b:Low Endotoxin
MBS211258-01 0.5 mg

MOUSE ANTI RAT CD11b:Low Endotoxin

Sign In for Pricing
View Details
MOUSE ANTI RAT CD11b:Low Endotoxin
MBS211258-02 5x 0.5 mg

MOUSE ANTI RAT CD11b:Low Endotoxin

Sign In for Pricing
View Details
CD3E Recombinant Rabbit mAb, PE-Cy5 conjugated
orb2346131 100 µL

CD3E Recombinant Rabbit mAb, PE-Cy5 conjugated

Sign In for Pricing
View Details