Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLFNL1 Rabbit Polyclonal Antibody (Biotin)

SLFNL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ23878, MGC43873

UniProt

Q499Z3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLFNL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASAIQEWCRQRWLVEL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659427

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Coagulation Factor XIII B Polypeptide (F13B) CLIA Kit
abx196829-01 96 Tests

Mouse Coagulation Factor XIII B Polypeptide (F13B) CLIA Kit

Sign In for Pricing
View Details
Mouse Coagulation Factor XIII B Polypeptide (F13B) CLIA Kit
abx196829-02 5x 96 Tests

Mouse Coagulation Factor XIII B Polypeptide (F13B) CLIA Kit

Sign In for Pricing
View Details
Mouse Coagulation Factor XIII B Polypeptide (F13B) CLIA Kit
abx196829-03 10x 96 Tests

Mouse Coagulation Factor XIII B Polypeptide (F13B) CLIA Kit

Sign In for Pricing
View Details
ZNF583 (NM_001159861) Human Tagged ORF Clone Lentiviral Particle
RC228963L4V 200 µL

ZNF583 (NM_001159861) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CMG1 Rabbit pAb, AE conjugated
orb2881654 100 µL

CMG1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
CERT1 (NM_031361) Human Over-expression Lysate
LS010087-100ug 100 µg

CERT1 (NM_031361) Human Over-expression Lysate

Sign In for Pricing
View Details