Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLFNL1 Rabbit Polyclonal Antibody (HRP)

SLFNL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ23878, MGC43873

UniProt

Q499Z3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLFNL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASAIQEWCRQRWLVEL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659427

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Recombinant Nuclear Receptor Related Protein 1 ELISA Kit
MBS3802824-01 48 Well

Human Recombinant Nuclear Receptor Related Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Recombinant Nuclear Receptor Related Protein 1 ELISA Kit
MBS3802824-02 96 Well

Human Recombinant Nuclear Receptor Related Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Recombinant Nuclear Receptor Related Protein 1 ELISA Kit
MBS3802824-03 5x 96 Well

Human Recombinant Nuclear Receptor Related Protein 1 ELISA Kit

Sign In for Pricing
View Details
Human Recombinant Nuclear Receptor Related Protein 1 ELISA Kit
MBS3802824-04 10x 96 Well

Human Recombinant Nuclear Receptor Related Protein 1 ELISA Kit

Sign In for Pricing
View Details
AdmiRa-hsa-mir-4284 Virus
mh0663 1.0 mL

AdmiRa-hsa-mir-4284 Virus

Sign In for Pricing
View Details
Recombinant Human Spondin 2/SPON2/Mindin (C-6His)
orb1648168-01 10 µg

Recombinant Human Spondin 2/SPON2/Mindin (C-6His)

Sign In for Pricing
View Details