Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STK32A Rabbit Polyclonal Antibody (HRP)

STK32A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

YANK1

UniProt

Q8WU08

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human STK32A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GANTSRKPPVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAM

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_659438

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MDA5 Monoclonal Antibody, Carrier-free
M00263-1-carrier-free 100 µL

Anti-MDA5 Monoclonal Antibody, Carrier-free

Sign In for Pricing
View Details
IFN-α/βRα (phospho Tyr466) Polyclonal Antibody
orb1097444-01 50 μL

IFN-α/βRα (phospho Tyr466) Polyclonal Antibody

Sign In for Pricing
View Details
IFN-α/βRα (phospho Tyr466) Polyclonal Antibody
orb1097444-02 100 µL

IFN-α/βRα (phospho Tyr466) Polyclonal Antibody

Sign In for Pricing
View Details
Goat soluble Triggering Receptor Expresses on Myeloid Cells 2 ELISA Kit
MBS7271023-01 48 Well

Goat soluble Triggering Receptor Expresses on Myeloid Cells 2 ELISA Kit

Sign In for Pricing
View Details
Goat soluble Triggering Receptor Expresses on Myeloid Cells 2 ELISA Kit
MBS7271023-02 96 Well

Goat soluble Triggering Receptor Expresses on Myeloid Cells 2 ELISA Kit

Sign In for Pricing
View Details
Goat soluble Triggering Receptor Expresses on Myeloid Cells 2 ELISA Kit
MBS7271023-03 5x 96 Well

Goat soluble Triggering Receptor Expresses on Myeloid Cells 2 ELISA Kit

Sign In for Pricing
View Details