Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBLCP1 Rabbit Polyclonal Antibody (Biotin)

UBLCP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CPUB1

UniProt

Q8WVY7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UBLCP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_659486

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RELA, CT (S536) (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 550) discontinued
040948-ML550 100 µL

RELA, CT (S536) (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Nrf2 Recombinant Rabbit mAb, PE-Cy7 conjugated
orb2837504 100 µL

Nrf2 Recombinant Rabbit mAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
Recombinant Anti-Midkine Rabbit mAb
CMA5373-01 30 µL

Recombinant Anti-Midkine Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Midkine Rabbit mAb
CMA5373-02 50 μL

Recombinant Anti-Midkine Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Midkine Rabbit mAb
CMA5373-03 100 µL

Recombinant Anti-Midkine Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Midkine Rabbit mAb
CMA5373-04 200 µL

Recombinant Anti-Midkine Rabbit mAb

Sign In for Pricing
View Details