Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBLCP1 Rabbit Polyclonal Antibody (Biotin)

UBLCP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CPUB1

UniProt

Q8WVY7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UBLCP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_659486

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC13A2 Protein Lysate
OCOA13342-20UG 20 µg

SLC13A2 Protein Lysate

Sign In for Pricing
View Details
LOC680770 3'UTR GFP Stable Cell Line
TU260680 1.0 mL

LOC680770 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
TFPI (Tissue Factor Pathway Inhibitor, TFI, TFPI 1, TFPI1, Extrinsic Pathway Inhibitor, EPI, Lipoprotein-associated Coagulation Inhibitor, LACI) (HRP)
134372-HRP 100 µL

TFPI (Tissue Factor Pathway Inhibitor, TFI, TFPI 1, TFPI1, Extrinsic Pathway Inhibitor, EPI, Lipoprotein-associated Coagulation Inhibitor, LACI) (HRP)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS614711 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (MaxLight 550)
MBS6401512-01 0.1 mL

NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (MaxLight 550)

Sign In for Pricing
View Details
NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (MaxLight 550)
MBS6401512-02 5x 0.1 mL

NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (MaxLight 550)

Sign In for Pricing
View Details