Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFAP52 Rabbit Polyclonal Antibody (HRP)

CFAP52 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WDR16, WDRPUH

UniProt

Q8N1V2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human WDR16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILANTLFQCVCYHPEEFQIITSGTDRKIAYWEVFDGTVIRELEGSLSGSI

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001074025

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRRT, NT (SRRT, ARS2, ASR2, Serrate RNA effector molecule homolog, Arsenite-resistance protein 2) (MaxLight 750)
MBS6351266-01 0.1 mL

SRRT, NT (SRRT, ARS2, ASR2, Serrate RNA effector molecule homolog, Arsenite-resistance protein 2) (MaxLight 750)

Sign In for Pricing
View Details
SRRT, NT (SRRT, ARS2, ASR2, Serrate RNA effector molecule homolog, Arsenite-resistance protein 2) (MaxLight 750)
MBS6351266-02 5x 0.1 mL

SRRT, NT (SRRT, ARS2, ASR2, Serrate RNA effector molecule homolog, Arsenite-resistance protein 2) (MaxLight 750)

Sign In for Pricing
View Details
ZFP64 Protein Vector (Human) (pPB-C-His)
PV047181 500 ng

ZFP64 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
PHC2, ID (PHC2, EDR2, PH2, Polyhomeotic-like protein 2, Early development regulatory protein 2) (PE) discontinued
039939-PE 200 µL

PHC2, ID (PHC2, EDR2, PH2, Polyhomeotic-like protein 2, Early development regulatory protein 2) (PE) discontinued

Sign In for Pricing
View Details
Anti-Neurofilament Antibody
V9056IHC-7ML 7 mL

Anti-Neurofilament Antibody

Sign In for Pricing
View Details
ZNF324, CT (ZNF324, ZNF324A, Zinc finger protein 324A, Zinc finger protein ZF5128) (MaxLight 490)
MBS6366234-01 0.1 mL

ZNF324, CT (ZNF324, ZNF324A, Zinc finger protein 324A, Zinc finger protein ZF5128) (MaxLight 490)

Sign In for Pricing
View Details