Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIRAS1 Rabbit Polyclonal Antibody (HRP)

DIRAS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RIG, GBTS1, Di-Ras1

UniProt

O95057

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DIRAS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660156

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal EGLN3/PHD3 Antibody
NB100-303SS 0.025 mL

Rabbit Polyclonal EGLN3/PHD3 Antibody

Sign In for Pricing
View Details
Leibovitz's L-15 Complete Medium (10)
PM151010B 4x 125 mL

Leibovitz's L-15 Complete Medium (10)

Sign In for Pricing
View Details
Hydroxypyruvic acid
orb1706171 10 mg

Hydroxypyruvic acid

Sign In for Pricing
View Details
Mouse SLC2A8 shRNA Plasmid
abx974591-01 150 µg

Mouse SLC2A8 shRNA Plasmid

Sign In for Pricing
View Details
Mouse SLC2A8 shRNA Plasmid
abx974591-02 300 µg

Mouse SLC2A8 shRNA Plasmid

Sign In for Pricing
View Details
Human NF1 (Neurofibromin) ELISA Kit
EH2385 96 Tests

Human NF1 (Neurofibromin) ELISA Kit

Sign In for Pricing
View Details