Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIRAS1 Rabbit Polyclonal Antibody (Biotin)

DIRAS1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RIG, GBTS1, Di-Ras1

UniProt

O95057

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DIRAS1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVK

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660156

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GOLGA7 (Golgin Subfamily A Member 7, Golgin A7, GOLGA7A, GOLGA3AP1, Golgi Complex-associated Protein of 16kD, GCP16, HDCKB03P, HSPC041, MGC4876, MGC21096) (MaxLight 490)
127460-ML490 100 µL

GOLGA7 (Golgin Subfamily A Member 7, Golgin A7, GOLGA7A, GOLGA3AP1, Golgi Complex-associated Protein of 16kD, GCP16, HDCKB03P, HSPC041, MGC4876, MGC21096) (MaxLight 490)

Sign In for Pricing
View Details
Lentiviral mouse Ecpas shRNA (UAS) - Lentiviral mouse Ecpas shRNA (UAS, GFP) plasmid
GTR15193882 1 Vial

Lentiviral mouse Ecpas shRNA (UAS) - Lentiviral mouse Ecpas shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
(Pimurutamab) Biosimilar Reference Antibody
orb3158821-01 100 µg

(Pimurutamab) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Pimurutamab) Biosimilar Reference Antibody
orb3158821-02 1 mg

(Pimurutamab) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Pimurutamab) Biosimilar Reference Antibody
orb3158821-03 5 mg

(Pimurutamab) Biosimilar Reference Antibody

Sign In for Pricing
View Details
(Pimurutamab) Biosimilar Reference Antibody
orb3158821-04 10 mg

(Pimurutamab) Biosimilar Reference Antibody

Sign In for Pricing
View Details