Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAM84A Rabbit Polyclonal Antibody (HRP)

FAM84A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NSE1, FAM84A, PP11517

UniProt

Q96KN4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM84A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYZL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV655778 1.0 µg DNA

LYZL1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
KREMEN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1164706 1.0 µg DNA

KREMEN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Porcine Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit
MBS9399147-01 48 Strip Well

Porcine Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit

Sign In for Pricing
View Details
Porcine Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit
MBS9399147-02 96 Strip Well

Porcine Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit

Sign In for Pricing
View Details
Porcine Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit
MBS9399147-03 5x 96 Strip Well

Porcine Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit

Sign In for Pricing
View Details
Porcine Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit
MBS9399147-04 10x 96 Strip Well

Porcine Matrix Metalloproteinase-Derived Fragments of Type II Collagen (C2M) ELISA Kit

Sign In for Pricing
View Details