Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSNK1A1L Rabbit Polyclonal Antibody (FITC)

CSNK1A1L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CK1

UniProt

Q8N752

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CSNK1A1L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660204

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP-10 (Matrix Metalloproteinase 10) BioAssayTM ELISA Kit (Mouse) discontinued
383694 96 Tests

MMP-10 (Matrix Metalloproteinase 10) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
Zyppy™ Elution Buffer (20 mL)
D4036-5-20 20 mL

Zyppy™ Elution Buffer (20 mL)

Sign In for Pricing
View Details
Rabbit Guinea Pig IgG (heavy and light chains) Antibody
orb21510 10 mg

Rabbit Guinea Pig IgG (heavy and light chains) Antibody

Sign In for Pricing
View Details
HLA Class 1 Antigen G (HLA Cass I Histocompatibility Antigen alpha Chain G, HLA G Antigen, HLA G, HLAG, HLA-G, HLA-6.0, Major Histocompatibility Complex Class I G, MHC-G) (PE)
H6098-72R3 100 µg

HLA Class 1 Antigen G (HLA Cass I Histocompatibility Antigen alpha Chain G, HLA G Antigen, HLA G, HLAG, HLA-G, HLA-6.0, Major Histocompatibility Complex Class I G, MHC-G) (PE)

Sign In for Pricing
View Details
SLC6A6 Protein Vector (Human) (pPB-C-His)
PV038997 500 ng

SLC6A6 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
NCAPH Antibody
orb1424116 100 µL

NCAPH Antibody

Sign In for Pricing
View Details