Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OMA1 Rabbit Polyclonal Antibody (FITC)

OMA1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DAB1, MPRP1, MPRP-1, YKR087C, ZMPOMA1, peptidase, 2010001O09Rik

UniProt

Q96E52

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human OMA1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660286

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP15 Double Nickase Plasmid (h2)
sc-402416-NIC-2 20 µg

USP15 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Pol III RPC39 (C39-2) Alexa Fluor® 546
sc-23913 AF546 200 µg/mL

Pol III RPC39 (C39-2) Alexa Fluor® 546

Sign In for Pricing
View Details
Parkin (FRA6E, Ubiquitin E3 Ligase PRKN, Parkinson Disease Protein 2, Parkinson Juvenile Disease Protein 2, PARK 2, PARK2, PDJ, Parkinson Disease (Autosomal Recessive Juvenile) 2, PRKN, LPRS 2, PRKN2, AR JP, PRKN 2, LPRS2, E3 Ubiquitin Protein Ligase Parkin) (FITC)
301446-FITC 100 µL

Parkin (FRA6E, Ubiquitin E3 Ligase PRKN, Parkinson Disease Protein 2, Parkinson Juvenile Disease Protein 2, PARK 2, PARK2, PDJ, Parkinson Disease (Autosomal Recessive Juvenile) 2, PRKN, LPRS 2, PRKN2, AR JP, PRKN 2, LPRS2, E3 Ubiquitin Protein Ligase Parkin) (FITC)

Sign In for Pricing
View Details
ZGPAT Rabbit pAb
A16583-01 20 µL

ZGPAT Rabbit pAb

Sign In for Pricing
View Details
ZGPAT Rabbit pAb
A16583-02 100 μL

ZGPAT Rabbit pAb

Sign In for Pricing
View Details
ZGPAT Rabbit pAb
A16583-03 500 μL

ZGPAT Rabbit pAb

Sign In for Pricing
View Details