Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNASE11 Rabbit Polyclonal Antibody (FITC)

RNASE11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RAJ1, C14orf6, HEL-S-84p

UniProt

Q8TAA1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RNASE11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_660293

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ferritin Heavy Chain/FTH1 Rabbit Polyclonal Antibody (RBITC)
orb1042983 100 µL

Ferritin Heavy Chain/FTH1 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
GSTT1 (Glutathione S-Transferase theta 1) (MaxLight 490)
MBS6206512-01 0.1 mL

GSTT1 (Glutathione S-Transferase theta 1) (MaxLight 490)

Sign In for Pricing
View Details
GSTT1 (Glutathione S-Transferase theta 1) (MaxLight 490)
MBS6206512-02 5x 0.1 mL

GSTT1 (Glutathione S-Transferase theta 1) (MaxLight 490)

Sign In for Pricing
View Details
Phosphatase, Alkaline, Bone (Akp2, ALPI, ALPL) (HRP)
P4071-04E-HRP 100 µL

Phosphatase, Alkaline, Bone (Akp2, ALPI, ALPL) (HRP)

Sign In for Pricing
View Details
Rabbit Anti-Mouse Never in Mitosis Gene A Related Kinase 2 (NEK2) Polyclonal Antibody
VD3N486 1 Each

Rabbit Anti-Mouse Never in Mitosis Gene A Related Kinase 2 (NEK2) Polyclonal Antibody

Sign In for Pricing
View Details
RNF126 (Ring Finger Protein 126, FLJ20552, MGC1022, MGC14317) (MaxLight 650)
251169-ML650 100 µL

RNF126 (Ring Finger Protein 126, FLJ20552, MGC1022, MGC14317) (MaxLight 650)

Sign In for Pricing
View Details