Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNASE11 Rabbit Polyclonal Antibody (FITC)

RNASE11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RAJ1, C14orf6, HEL-S-84p

UniProt

Q8TAA1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RNASE11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_660293

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Laboratory Water Purification System BLPS-604
BLPS-604 1 Unit

Laboratory Water Purification System BLPS-604

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), Biotin conjugate, 0.1mg/mL
BNCB1143-100 1x 100 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker), CF568 conjugate, 0.1mg/mL
BNC681498-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details