Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNASE11 Rabbit Polyclonal Antibody (HRP)

RNASE11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAJ1, C14orf6, HEL-S-84p

UniProt

Q8TAA1

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RNASE11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Equine, Guinea pig, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_660293

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCI-32765 Racemate
B3242-10 10 mg

PCI-32765 Racemate

Sign In for Pricing
View Details
STAT3, Phosphorylated (Ser727) (Signal Transducer and Activator of Transcription 3, Acute-phase Response Factor, APRF, FLJ20882, MGC16063) (Biotin)
MBS6500970-01 0.2 mL

STAT3, Phosphorylated (Ser727) (Signal Transducer and Activator of Transcription 3, Acute-phase Response Factor, APRF, FLJ20882, MGC16063) (Biotin)

Sign In for Pricing
View Details
STAT3, Phosphorylated (Ser727) (Signal Transducer and Activator of Transcription 3, Acute-phase Response Factor, APRF, FLJ20882, MGC16063) (Biotin)
MBS6500970-02 5x 0.2 mL

STAT3, Phosphorylated (Ser727) (Signal Transducer and Activator of Transcription 3, Acute-phase Response Factor, APRF, FLJ20882, MGC16063) (Biotin)

Sign In for Pricing
View Details
Prodilidine hydrochloride
orb1699595-01 25 mg

Prodilidine hydrochloride

Sign In for Pricing
View Details
Prodilidine hydrochloride
orb1699595-02 50 mg

Prodilidine hydrochloride

Sign In for Pricing
View Details
Prodilidine hydrochloride
orb1699595-03 100 mg

Prodilidine hydrochloride

Sign In for Pricing
View Details