Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1orf96 Rabbit Polyclonal Antibody (HRP)

C1orf96 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CSAP, C1orf96

UniProt

Q6IQ19

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1orf96

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENKHPFALYGWGEKQTDTGSQKTHNVCASAPVHEIHESALRAKNRRQVEK

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_660300

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Lung
CS803447 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
Colloidal Gold Conjugated Arachis hypogaea Lectin (Peanut) -PNA-,  40nm
GP-2301-40 1 mL

Colloidal Gold Conjugated Arachis hypogaea Lectin (Peanut) -PNA-, 40nm

Sign In for Pricing
View Details
HSD17B13 (NM_001136230) Human Over-expression Lysate
LY427863 100 µg

HSD17B13 (NM_001136230) Human Over-expression Lysate

Sign In for Pricing
View Details
RHAG Polyclonal Antibody
E-AB-19025-01 20 µL

RHAG Polyclonal Antibody

Sign In for Pricing
View Details
RHAG Polyclonal Antibody
E-AB-19025-02 60 µL

RHAG Polyclonal Antibody

Sign In for Pricing
View Details
RHAG Polyclonal Antibody
E-AB-19025-03 120 µL

RHAG Polyclonal Antibody

Sign In for Pricing
View Details