Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR1C Rabbit Polyclonal Antibody (HRP)

ACVR1C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALK7, ACVRLK7

UniProt

Q8NER5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ACVR1C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITVP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660302

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vom1r16 3'UTR Lenti-reporter-Luc Vector
50002086 1.0 µg

Vom1r16 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
POMC Antibody
R34762-100UG 100 µg

POMC Antibody

Sign In for Pricing
View Details
HSP70 (78kD Glucose-regulated Protein, GRP 78, Heat Shock 70kD Protein 5, Immunoglobulin Heavy Chain-binding Protein, BiP, Endoplasmic Reticulum Lumenal Ca(2+)-binding Protein grp78, HSPA5, GRP78) (MaxLight 750)
MBS6479793-01 0.1 mL

HSP70 (78kD Glucose-regulated Protein, GRP 78, Heat Shock 70kD Protein 5, Immunoglobulin Heavy Chain-binding Protein, BiP, Endoplasmic Reticulum Lumenal Ca(2+)-binding Protein grp78, HSPA5, GRP78) (MaxLight 750)

Sign In for Pricing
View Details
HSP70 (78kD Glucose-regulated Protein, GRP 78, Heat Shock 70kD Protein 5, Immunoglobulin Heavy Chain-binding Protein, BiP, Endoplasmic Reticulum Lumenal Ca(2+)-binding Protein grp78, HSPA5, GRP78) (MaxLight 750)
MBS6479793-02 5x 0.1 mL

HSP70 (78kD Glucose-regulated Protein, GRP 78, Heat Shock 70kD Protein 5, Immunoglobulin Heavy Chain-binding Protein, BiP, Endoplasmic Reticulum Lumenal Ca(2+)-binding Protein grp78, HSPA5, GRP78) (MaxLight 750)

Sign In for Pricing
View Details
ETV1 (ETS Translocation Variant 1, Ets-related Protein 81, ER81) (MaxLight 550)
MBS6211394-01 0.1 mL

ETV1 (ETS Translocation Variant 1, Ets-related Protein 81, ER81) (MaxLight 550)

Sign In for Pricing
View Details
ETV1 (ETS Translocation Variant 1, Ets-related Protein 81, ER81) (MaxLight 550)
MBS6211394-02 5x 0.1 mL

ETV1 (ETS Translocation Variant 1, Ets-related Protein 81, ER81) (MaxLight 550)

Sign In for Pricing
View Details