Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXNL2 Rabbit Polyclonal Antibody (Biotin)

NXNL2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RDCVF2, RdCVF2L, C9orf121

UniProt

Q5VZ03

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NXNL2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHC

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660326

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX6A2, ID (COX6A2, COX6A, COX6AH, Cytochrome c oxidase subunit 6A2, mitochondrial, Cytochrome c oxidase polypeptide VIa-heart, Cytochrome c oxidase subunit VIA-muscle) (Biotin)
MBS6288122-01 0.2 mL

COX6A2, ID (COX6A2, COX6A, COX6AH, Cytochrome c oxidase subunit 6A2, mitochondrial, Cytochrome c oxidase polypeptide VIa-heart, Cytochrome c oxidase subunit VIA-muscle) (Biotin)

Sign In for Pricing
View Details
COX6A2, ID (COX6A2, COX6A, COX6AH, Cytochrome c oxidase subunit 6A2, mitochondrial, Cytochrome c oxidase polypeptide VIa-heart, Cytochrome c oxidase subunit VIA-muscle) (Biotin)
MBS6288122-02 5x 0.2 mL

COX6A2, ID (COX6A2, COX6A, COX6AH, Cytochrome c oxidase subunit 6A2, mitochondrial, Cytochrome c oxidase polypeptide VIa-heart, Cytochrome c oxidase subunit VIA-muscle) (Biotin)

Sign In for Pricing
View Details
Ebi3 ORF Vector (Rat) (pORF)
ORF066329 1.0 µg DNA

Ebi3 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
2,3-Desisopropylidene topiramate
MD21212-01 1 mg

2,3-Desisopropylidene topiramate

Sign In for Pricing
View Details
2,3-Desisopropylidene topiramate
MD21212-02 2 mg

2,3-Desisopropylidene topiramate

Sign In for Pricing
View Details
2,3-Desisopropylidene topiramate
MD21212-03 5 mg

2,3-Desisopropylidene topiramate

Sign In for Pricing
View Details