Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NXNL2 Rabbit Polyclonal Antibody (HRP)

NXNL2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RDCVF2, RdCVF2L, C9orf121

UniProt

Q5VZ03

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NXNL2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRLECSGVILAHC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660326

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RPAP3 shRNA (UAS) - Lentiviral human RPAP3 shRNA (UAS, GFP) plasmid
GTR15132358 1 Vial

Lentiviral human RPAP3 shRNA (UAS) - Lentiviral human RPAP3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
IFluor® 700 Anti-human CD5 Antibody *UCHT2*
100520J1-AAT 500 Tests

IFluor® 700 Anti-human CD5 Antibody *UCHT2*

Sign In for Pricing
View Details
AMPK Activator
sc-203819C 50 mg

AMPK Activator

Sign In for Pricing
View Details
GRK2 Rabbit Polyclonal Antibody (Cy5)
orb1810323 100 µL

GRK2 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
EDIL3 Rabbit Polyclonal Antibody
54091-01 50 µL

EDIL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EDIL3 Rabbit Polyclonal Antibody
54091-02 100 µL

EDIL3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details