Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fam122b Rabbit Polyclonal Antibody (FITC)

Fam122b Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Pabir2, SPACIA2, AI256344, 4632404H22Rik

UniProt

Q6NZE7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SWDESLSLSDSDFDKPEKLYSPKRIDFTPVSPAPSPTRGFGKQCLSPSLQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_084443

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Bcap29 activation kit by CRISPRa
GA200374 1 Kit

Mouse Bcap29 activation kit by CRISPRa

Sign In for Pricing
View Details
CMPK1 (C-term) Rabbit Polyclonal Antibody
AP15098PU-N 400 µL

CMPK1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RACGAP1 (NM_013277) Human Recombinant Protein
TP307542M 100 µg

RACGAP1 (NM_013277) Human Recombinant Protein

Sign In for Pricing
View Details
Human ZFP91 activation kit by CRISPRa
GA112993 1 Kit

Human ZFP91 activation kit by CRISPRa

Sign In for Pricing
View Details
GPD1 Goat Polyclonal Antibody
TA396666S 25 µL

GPD1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF640R conjugate, 0.1mg/mL
BNC401953-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details