Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STOML3 Rabbit Polyclonal Antibody (HRP)

STOML3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SRO, Epb7.2l

UniProt

Q8TAV4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human STOML3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660329

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans Y43F4A.1 Polyclonal Antibody
MBS7140082 Inquire

Rabbit anti-Caenorhabditis elegans Y43F4A.1 Polyclonal Antibody

Sign In for Pricing
View Details
Sheep Gem-associated protein 2 ELISA kit
GTR10469207 96 Well

Sheep Gem-associated protein 2 ELISA kit

Sign In for Pricing
View Details
Tau (Phospho-Ser214) Antibody
ABM0205 100 µL

Tau (Phospho-Ser214) Antibody

Sign In for Pricing
View Details
Rat Dcaf5 Pre-designed siRNA Set B
SI203576B 1 Each

Rat Dcaf5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
B4galnt4 siRNA Oligos set (Rat)
12951176 3x 5 nmol

B4galnt4 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
α-horse IgG conjugate HRPO
EIAR α-horse conjugate IgG 1 mL

α-horse IgG conjugate HRPO

Sign In for Pricing
View Details