Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STOML3 Rabbit Polyclonal Antibody (HRP)

STOML3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SRO, Epb7.2l

UniProt

Q8TAV4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human STOML3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_660329

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPC014 (POMP) CytoSection
TS404812P5 25 Slides

HSPC014 (POMP) CytoSection

Sign In for Pricing
View Details
Cullin 4B/CUL4B Rabbit Polyclonal Antibody (PE)
orb2579654 100 µg

Cullin 4B/CUL4B Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
OR2L8, CT (OR2L8, Olfactory receptor 2L8, Olfactory receptor OR1-46) (MaxLight 650) discontinued
039361-ML650 100 µL

OR2L8, CT (OR2L8, Olfactory receptor 2L8, Olfactory receptor OR1-46) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Sheep Polyclonal anti-mouse Syntaxin 1A
mAP-5466 50 µg

Sheep Polyclonal anti-mouse Syntaxin 1A

Sign In for Pricing
View Details
Human C9orf152 qPCR Primer Pair
QH77281S 200 Tests

Human C9orf152 qPCR Primer Pair

Sign In for Pricing
View Details
Goat brucella antibody IgG, brucella Ab IgG ELISA KIT
ED0000GO-01 96 Well

Goat brucella antibody IgG, brucella Ab IgG ELISA KIT

Sign In for Pricing
View Details