Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIGD1 Rabbit Polyclonal Antibody (Biotin)

TIGD1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EEYORE

UniProt

Q96MW7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TIGD1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_663748

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin Monoclonal Antibody, RBITC Conjugated
bsm-33307M-RBITC 100 µL

Ubiquitin Monoclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
CD117 (c-kit, Stem Cell Factor, SCF, Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 750)
MBS6256511-01 0.1 mL

CD117 (c-kit, Stem Cell Factor, SCF, Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 750)

Sign In for Pricing
View Details
CD117 (c-kit, Stem Cell Factor, SCF, Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 750)
MBS6256511-02 5x 0.1 mL

CD117 (c-kit, Stem Cell Factor, SCF, Receptor, Steel Factor Receptor, Mast Cell Growth Factor, MGF) (MaxLight 750)

Sign In for Pricing
View Details
Recombinant Mouse PPT1 Protein, N-His
orb2831260-01 20 µg

Recombinant Mouse PPT1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse PPT1 Protein, N-His
orb2831260-02 50 µg

Recombinant Mouse PPT1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse PPT1 Protein, N-His
orb2831260-03 100 µg

Recombinant Mouse PPT1 Protein, N-His

Sign In for Pricing
View Details