Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tigd4 Rabbit Polyclonal Antibody (FITC)

Tigd4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Tigd, Gm418, C130063O11Rik

UniProt

Q8BUZ3

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGISIDPS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_997161

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NT-proBNP (N-terminal pro-Brain Natriuretic Peptide) CLIA Kit
E-CL-M0518-01 24 Tests

Mouse NT-proBNP (N-terminal pro-Brain Natriuretic Peptide) CLIA Kit

Sign In for Pricing
View Details
Mouse NT-proBNP (N-terminal pro-Brain Natriuretic Peptide) CLIA Kit
E-CL-M0518-02 48 Tests

Mouse NT-proBNP (N-terminal pro-Brain Natriuretic Peptide) CLIA Kit

Sign In for Pricing
View Details
Mouse NT-proBNP (N-terminal pro-Brain Natriuretic Peptide) CLIA Kit
E-CL-M0518-03 96 Tests

Mouse NT-proBNP (N-terminal pro-Brain Natriuretic Peptide) CLIA Kit

Sign In for Pricing
View Details
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF488A conjugate, 0.1mg/mL
BNC882153-100 1x 100 µL

TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2153), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RRP12 (NM_015179) Human Recombinant Protein
TP303502L 1 mg

RRP12 (NM_015179) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Kbtbd11 activation kit by CRISPRa
GA210039 1 Kit

Mouse Kbtbd11 activation kit by CRISPRa

Sign In for Pricing
View Details