Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo32 Rabbit Polyclonal Antibody (Biotin)

Fbxo32 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ATR, MAFb, atro, MAFbx, Gm20361, AI430017, ATROGIN1, 4833442G10Rik

UniProt

Q9CPU7

Immunogen

The immunogen is a synthetic peptide corresponding to a region from the human protein.

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080622

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAK, CT (MAK, Serine/threonine-protein kinase MAK, Male germ cell-associated kinase) (APC)
MBS6318111-01 0.2 mL

MAK, CT (MAK, Serine/threonine-protein kinase MAK, Male germ cell-associated kinase) (APC)

Sign In for Pricing
View Details
MAK, CT (MAK, Serine/threonine-protein kinase MAK, Male germ cell-associated kinase) (APC)
MBS6318111-02 5x 0.2 mL

MAK, CT (MAK, Serine/threonine-protein kinase MAK, Male germ cell-associated kinase) (APC)

Sign In for Pricing
View Details
Active Oxoguanine Glycosylase 1 (OGG1)
TRV-0005451-01 10 µg

Active Oxoguanine Glycosylase 1 (OGG1)

Sign In for Pricing
View Details
Active Oxoguanine Glycosylase 1 (OGG1)
TRV-0005451-02 50 µg

Active Oxoguanine Glycosylase 1 (OGG1)

Sign In for Pricing
View Details
Active Oxoguanine Glycosylase 1 (OGG1)
TRV-0005451-03 100 µg

Active Oxoguanine Glycosylase 1 (OGG1)

Sign In for Pricing
View Details
Active Oxoguanine Glycosylase 1 (OGG1)
TRV-0005451-04 200 µg

Active Oxoguanine Glycosylase 1 (OGG1)

Sign In for Pricing
View Details