Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Otos Rabbit Polyclonal Antibody (HRP)

Otos Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

OTOSP

UniProt

Q8R448

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YWPFSTSDFWNYVQYFQTQGAYPQIEDMARTFFAHFPLGSTLGFHVPYQE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_694754

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHFR (E3 Ubiquitin-protein Ligase CHFR, Checkpoint with Forkhead and RING Finger Domains Protein, RING Finger Protein 196, RNF196, FLJ10796, FLJ33629) (MaxLight 550)
124937-ML550 100 µL

CHFR (E3 Ubiquitin-protein Ligase CHFR, Checkpoint with Forkhead and RING Finger Domains Protein, RING Finger Protein 196, RNF196, FLJ10796, FLJ33629) (MaxLight 550)

Sign In for Pricing
View Details
Phospho-YAP1 (Tyr407) Rabbit Polyclonal Antibody
orb5631-01 50 μL

Phospho-YAP1 (Tyr407) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-YAP1 (Tyr407) Rabbit Polyclonal Antibody
orb5631-02 100 µL

Phospho-YAP1 (Tyr407) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-YAP1 (Tyr407) Rabbit Polyclonal Antibody
orb5631-03 200 µL

Phospho-YAP1 (Tyr407) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Tyrosine protein kinase Fyn (FYN) ELISA kit
GTR10438860 96 Well

Rabbit Tyrosine protein kinase Fyn (FYN) ELISA kit

Sign In for Pricing
View Details
FRG2B Polyclonal Antibody, APC-Cy7 Conjugated
bs-9549R-APC-Cy7 100 µL

FRG2B Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details