Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C11orf46 Rabbit Polyclonal Antibody (FITC)

C11orf46 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ARF7EP, C11orf46, dJ299F11.1

UniProt

Q8N8R7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C11orf46

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (C4/206), Biotin conjugate, 0.1mg/mL
BNCB0206-500 1x 500 µL

CD4 (C4/206), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Floor Type High Speed Refrigerated Centrifuge BCFHR-304
BCFHR-304 1 Unit

Floor Type High Speed Refrigerated Centrifuge BCFHR-304

Sign In for Pricing
View Details
Human NLRP3 Recombinant Rabbit monoclonal Antibody
HA723276 100 µL

Human NLRP3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
VAV2 Recombinant Rabbit Monoclonal Antibody [SC68-03]
ET1610-79 100 µL

VAV2 Recombinant Rabbit Monoclonal Antibody [SC68-03]

Sign In for Pricing
View Details
Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit
E-EL-M3071-01 24 Tests

Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details
Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit
E-EL-M3071-02 48 Tests

Mouse TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit

Sign In for Pricing
View Details