Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C11orf46 Rabbit Polyclonal Antibody (HRP)

C11orf46 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ARF7EP, C11orf46, dJ299F11.1

UniProt

Q8N8R7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C11orf46

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSNDMLLLQLRTGMTLSGNNTICFHHVKIYIDRFEDLQKSCCDPFNIHKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_689529

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (Membrane Metalloendopeptidase) (MME/1892), CF488A conjugate, 0.1mg/mL
BNC881892-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1892), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tide Quencher™ 7WS acid [TQ7WS acid]
2105-AAT 5 mg

Tide Quencher™ 7WS acid [TQ7WS acid]

Sign In for Pricing
View Details
Human TFPT activation kit by CRISPRa
GA109281 1 Kit

Human TFPT activation kit by CRISPRa

Sign In for Pricing
View Details
PRPS1 (NM_002764) Human Over-expression Lysate
LC400979 20 µg

PRPS1 (NM_002764) Human Over-expression Lysate

Sign In for Pricing
View Details
Deoxyribonuclease I like 1 (DNASE1L1) (NM_001009934) Human Recombinant Protein
TP323658L 1 mg

Deoxyribonuclease I like 1 (DNASE1L1) (NM_001009934) Human Recombinant Protein

Sign In for Pricing
View Details
MEX3C (541-554) Goat Polyclonal Antibody
AP32849PU-N 100 µg

MEX3C (541-554) Goat Polyclonal Antibody

Sign In for Pricing
View Details